Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H8K6K3

dbSWEET id: dbswt_2003

Accession:   H8K6K3

Uniprot status:   Unreviewed

Organism:   Rickettsia australis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rickettsiales ⇒ Rickettsiaceae ⇒ Rickettsieae ⇒ Rickettsia ⇒ spotted fever group.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   VAVA           CVV:   344       CHI:   12

Fasta sequence:

>tr|H8K6K3|H8K6K3_RICAC|Unreviewed|Rickettsia australis|88
MSPKFVKFYEKYMTIVGTIGNFMFYVQAHKIFTCKSSASVSMHAFTISAIALCSWLIYGI
LIKNIPIIIANIIGFIGALLVLLTIIIY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  H8K6K3_inward.pdb    Alignment file: H8K6K3_inw.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    11.4% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  H8K6K3_outward.pdb    Alignment file: H8K6K3_out.pir

Procheck score ⇒ Ramachandran plot: 92.4% favored    6.1% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  H8K6K3_occluded.pdb    Alignment file: H8K6K3_occ.pir

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.3% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur