Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : H3IC46
dbSWEET id: dbswt_1199
Accession: H3IC46
Uniprot status: Unreviewed
Organism: Strongylocentrotus purpuratus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Echinodermata ⇒ Eleutherozoa ⇒ Echinozoa ⇒ Echinoidea ⇒ Euechinoidea ⇒ Echinacea ⇒ Echinoida ⇒ Strongylocentrotidae ⇒ Strongylocentrotus.
Sequence Information back to top
Sequence length: 219
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: LNMV CVV: 449 CHI: 6.4
Fasta sequence:
>tr|H3IC46|H3IC46_STRPU|Unreviewed|Strongylocentrotus_purpuratus|219
MDFQSVLSLTATVSTIGLFLTGIQICMKIRSQGNTQNISIFPFIAGIINTVLWTKYGVLI
EDQTVIFTNGVGIVLQTLYTLIYYLNTNDKKQVHSKLLYTALIIYPTLGAVKFMNMTAAT
AIHYIGLASSFATVLMYAAPLSVVAQIIRTKSTEALPFPLSFVGLLVSLQWFIYGRLVQD
SFIQIPNFLGMLLGAFQMSLFIRYPGPSRKYDLAGSSVI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: H3IC46.pir
Inward Open:
Template: 5CTG.pdb
Model structure: H3IC46_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 7.1% allowed 2.2% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: H3IC46_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 6.0% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: H3IC46_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 7.6% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 100890911 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA