Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H3IC46

dbSWEET id: dbswt_1199

Accession:   H3IC46

Uniprot status:   Unreviewed

Organism:   Strongylocentrotus purpuratus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Echinodermata ⇒ Eleutherozoa ⇒ Echinozoa ⇒ Echinoidea ⇒ Euechinoidea ⇒ Echinacea ⇒ Echinoida ⇒ Strongylocentrotidae ⇒ Strongylocentrotus.

Sequence Information back to top


Sequence length:   219

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   LNMV           CVV:   449       CHI:   6.4

Fasta sequence:

>tr|H3IC46|H3IC46_STRPU|Unreviewed|Strongylocentrotus_purpuratus|219
MDFQSVLSLTATVSTIGLFLTGIQICMKIRSQGNTQNISIFPFIAGIINTVLWTKYGVLI
EDQTVIFTNGVGIVLQTLYTLIYYLNTNDKKQVHSKLLYTALIIYPTLGAVKFMNMTAAT
AIHYIGLASSFATVLMYAAPLSVVAQIIRTKSTEALPFPLSFVGLLVSLQWFIYGRLVQD
SFIQIPNFLGMLLGAFQMSLFIRYPGPSRKYDLAGSSVI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: H3IC46.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  H3IC46_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.1% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  H3IC46_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    6.0% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  H3IC46_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.6% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   100890911     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur