| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : H3EBQ9
dbSWEET id: dbswt_1198
Accession: H3EBQ9
Uniprot status: Unreviewed
Organism: Pristionchus pacificus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Diplogasterida ⇒ Neodiplogasteridae ⇒ Pristionchus.
Sequence Information back to top
Sequence length: 362
Substrate Binding Site: GQWN CVV: 400 CHI: -5.5
Selectivity Filter: LGDV CVV: 368 CHI: 4.1
Fasta sequence:
>tr|H3EBQ9|H3EBQ9_PRIPA|Unreviewed|Pristionchus_pacificus|362
MFEIFTHGFTFLNLLSCLAFITTVGLFFCGIPICRQIWKRGDTKEISGAPFLMGVVGGSC
WFAYGWLKKDYTVLYVTGTQILLYSVYSVFYWCMTKKKLWITLKVLAVIGLCCSLASAVY
FFGIKVFHPLGIVCMTLNAADFAAPLAGLKTVIRRRATSTLPLPLCIANFLVSSEWFLYG
ILVKDFYLITPNGIGCMFATAQIIMFIVLPRKPGMRPPIVKLYRRIASCCCKIDDAAEKD
VESDVEKVVPADPDAPQEDKLTRAHRWSKRVVANMAGEIESVFTKVGAYDQFGYSGKLNR
LEGDETPPGEAAGAQTNPIFTAEEMAEKLREEARKAKETSNSLRPHPSIPLRRVASSPDL
SE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 211
Alignment file: H3EBQ9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: H3EBQ9_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 5.6% allowed .6% week 1.7% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: H3EBQ9_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.0% favored 9.4% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: H3EBQ9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.9% favored 9.4% allowed .6% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA