Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H3DWR1

dbSWEET id: dbswt_1197

Accession:   H3DWR1

Uniprot status:   Unreviewed

Organism:   Pristionchus pacificus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Diplogasterida ⇒ Neodiplogasteridae ⇒ Pristionchus.

Sequence Information back to top


Sequence length:   223

Substrate Binding Site:   LYRY           CVV:   554       CHI:   -3.3

Selectivity Filter:   FMMM           CVV:   507       CHI:   8.5

Fasta sequence:

>tr|H3DWR1|H3DWR1_PRIPA|Unreviewed|Pristionchus_pacificus|223
MSLLSAYATFVAIYSALFMFFPLMIVRQWVKRKSAEGFSIMTFLLVNFMLACWVKFSILS
GDSRALYSYSFGLTMMSLYTVAFGFYTNNKKVFIIQISILLGLLAVIFSYVDGLPDDVSR
VATMGKIAAISQTAMIGGPFFQMKEVIAKGTSEYLSFGFIILSLTMVGNRFLLGLLQGNM
TIALGYFPGLAMNLGTLSMFYFYPPLTWRVPIIGTGPTQKKNE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   205

Alignment file: H3DWR1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  H3DWR1_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    7.2% allowed    .0% week    1.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  H3DWR1_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    6.1% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  H3DWR1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.1% allowed    .6% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur