Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H3DWR0

dbSWEET id: dbswt_1196

Accession:   H3DWR0

Uniprot status:   Unreviewed

Organism:   Pristionchus pacificus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Diplogasterida ⇒ Neodiplogasteridae ⇒ Pristionchus.

Sequence Information back to top


Sequence length:   220

Substrate Binding Site:   INWN           CVV:   479       CHI:   -3.4

Selectivity Filter:   FTSL           CVV:   425       CHI:   5.1

Fasta sequence:

>tr|H3DWR0|H3DWR0_PRIPA|Unreviewed|Pristionchus_pacificus|220
MDVFSIFAAWLAIFSISFTFLPILQILDWKARGTADGFSSVNFVLPVLTIACWLRHGYMT
DDVNNKLINSVNLAAFTVYIFCFAYFQPKYLYIQLLSLFAVLYATFAYVDSVDSSLAADT
MGGIAAAMQIVSLAGGIYDIKRAISMGTTEYIPASMQFGIFFLTGQWALFGYLAPNPYIM
VANLAGLAVNIVTIALYFIYPPITWRVPLIGTQQEHKKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   202

Alignment file: H3DWR0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  H3DWR0_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.5% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  H3DWR0_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.8% favored    7.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  H3DWR0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    7.2% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur