| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : H3AN52
dbSWEET id: dbswt_1194
Accession: H3AN52
Uniprot status: Unreviewed
Organism: Latimeria chalumnae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Coelacanthiformes ⇒ Coelacanthidae ⇒ Latimeria.
Sequence Information back to top
Sequence length: 217
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|H3AN52|H3AN52_LATCH|Unreviewed|Latimeria_chalumnae|217
MDLQLLSWACFIFTIVMFSTGLSDLKKMFSAQSTDNIQFLPFLTTDLNNLGWLYYGQLKE
DWTIITVNVIGASLQTFYILAYLYYTAQKCEVLVKTLMMLAVLFLGYFYFIVVVPDTNAR
LNQLGLSCSVFTISMYLSPLTDLVKIIRTRSTKCLSFPLTVATFLTSTSWTLYGQQLNDF
YIMIPNMPGILTSIIRFWLFWQYRSSQEKYSYRPLQA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 205
Alignment file: H3AN52.pir
Inward Open:
Template: 5CTG.pdb
Model structure: H3AN52_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.3% favored 9.6% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: H3AN52_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.4% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: H3AN52_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.9% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 102359174 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA