Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H2WBN1

dbSWEET id: dbswt_1192

Accession:   H2WBN1

Uniprot status:   Unreviewed

Organism:   Caenorhabditis japonica

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   358

Substrate Binding Site:   GQWN           CVV:   393       CHI:   -2.3

Selectivity Filter:   LGDV           CVV:   368       CHI:   4.1

Fasta sequence:

>tr|H2WBN1|H2WBN1_CAEJA|Unreviewed|Caenorhabditis_japonica|358
MFEIFTQGFSLLNFLSILAFFTTVGLFFCGIPICRQIWKRKDTTEISGAPFLMGIVGGCC
WMTYGWLKNDGTVKWVTGCQVILYTTYTIFYWFMTKKKLWISLKVLGVIAICTSLILGVH
FFGMKIFHPLGIVCLTLNIADFAAPLGGIRVVIRRWATSTLPLPLCIANFLVSTEWFLYG
LLKNDFYLIFPNGVGSLLAFIQLMLFIVLPRKPGQRAPIVKLWMWISGEKIEETKEIVAE
LGECDEKKMNRAQRWSQKIKMNVSTVAEELENVIYQLPTKDQFAYTHKIGEDDSSSEKTV
ETVDETKTKKSSAGAEAVEPTVVKDSEWERKLRNSLRHAGETRESALRRSISSPDLSD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   211

Alignment file: H2WBN1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  H2WBN1_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    10.1% allowed    .0% week    1.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  H2WBN1_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    6.2% allowed    2.2% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  H2WBN1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.4% allowed    1.1% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur