Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H2SYZ1

dbSWEET id: dbswt_1191

Accession:   H2SYZ1

Uniprot status:   Unreviewed

Organism:   Takifugu rubripes

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Actinopterygii ⇒ Neopterygii ⇒ Teleostei ⇒ Neoteleostei ⇒ Acanthomorphata ⇒ Eupercaria ⇒ Tetraodontiformes ⇒ Tetradontoidea ⇒ Tetraodontidae ⇒ Takifugu.

Sequence Information back to top


Sequence length:   219

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|H2SYZ1|H2SYZ1_TAKRU|Unreviewed|Takifugu_rubripes|219
MDLVNLLSWACIVFTLGMFSTGLSDMRKMQESKSTDNIQFLPFLTTCLNNLGWLYYGVLK
SDQTIILVNVIGALLQILYIIMYLRYTKVKNLVGAQTLIAGIILLCGWLYFTVFLPKGET
QLSQLGFTCSVVTVSMYLSPLSSLLEMVRSRDVQCLSFPLTVTTLLTSTSWVLYGLQVSD
LYIVVPNTPGIITSLIRFYLFWKFGSSHSGSPSYKPMPI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: H2SYZ1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  H2SYZ1_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.6% favored    9.2% allowed    1.1% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  H2SYZ1_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.2% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  H2SYZ1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.6% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   101073069     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur