Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H1WT54

dbSWEET id: dbswt_1811

Accession:   H1WT54

Uniprot status:   Unreviewed

Organism:   Leuconostoc citreum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|H1WT54|H1WT54_LEUCI|Unreviewed|Leuconostoc citreum|86
MKKKRFIRYLSWVATAMAIMMYVSYIPQIMDNLSGSKGNPIQPLVAAINCLLWVVYALYK
DQRDIPVALANFPGIIFGLIAFLTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  H1WT54_inward.pdb    Alignment file: H1WT54_inw.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.2% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  H1WT54_outward.pdb    Alignment file: H1WT54_out.pir

Procheck score ⇒ Ramachandran plot: 88.5% favored    9.2% allowed    1.5% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  H1WT54_occluded.pdb    Alignment file: H1WT54_occ.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    4.6% allowed    1.5% week    1.5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur