Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : H1Q0C6
dbSWEET id: dbswt_1810
Accession: H1Q0C6
Uniprot status: Unreviewed
Organism: Prevotella micans
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 77
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|H1Q0C6|H1Q0C6_9BACT|Unreviewed|Prevotella micans|77
MGWVGMATSVMMYIFYFPQIQNNLAGHKGTFIQPFMAGINCTLWVAYGLFKEKRDLPLAI
ANTPGIIFGFVAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 78 Inward Open: Template: 4X5M.pdb Model structure: H1Q0C6_inward.pdb Alignment file: H1Q0C6_inw.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.9% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: H1Q0C6_outward.pdb Alignment file: H1Q0C6_out.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.9% allowed .0% week .8% disallowed Occluded: Model structure: H1Q0C6_occluded.pdb Alignment file: H1Q0C6_occ.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.9% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA