Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H1HWB5

dbSWEET id: dbswt_1807

Accession:   H1HWB5

Uniprot status:   Unreviewed

Organism:   Stomatobaculum longum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Stomatobaculum.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|H1HWB5|H1HWB5_9FIRM|Unreviewed|Stomatobaculum longum|86
MSQKALTALGWIATCVAVMMYVSYIPQIMNNLHGMKGTPIQPLVAAVNCTLWVTYALLKK
NRDYPVALANAPGIVFGLIAAITAII

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  H1HWB5_inward.pdb    Alignment file: H1HWB5_inw.pir

Procheck score ⇒ Ramachandran plot: 91.5% favored    5.4% allowed    .0% week    3.1% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  H1HWB5_outward.pdb    Alignment file: H1HWB5_out.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    3.8% allowed    2.3% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  H1HWB5_occluded.pdb    Alignment file: H1HWB5_occ.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    3.8% allowed    1.5% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur