Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : H1HW36
dbSWEET id: dbswt_1806
Accession: H1HW36
Uniprot status: Unreviewed
Organism: Stomatobaculum longum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Stomatobaculum.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|H1HW36|H1HW36_9FIRM|Unreviewed|Stomatobaculum longum|87
MTKQKLNLLVGSIGAFIGIFVFIAYIPQIYSNLQGSKAQPFQPLFAAISCLIWVIYGWTK
EPKKDWILIIPNSAGVILGGLTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: H1HW36_inward.pdb Alignment file: H1HW36_inw.pir Procheck score ⇒ Ramachandran plot: 86.5% favored 10.3% allowed 2.4% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: H1HW36_outward.pdb Alignment file: H1HW36_out.pir Procheck score ⇒ Ramachandran plot: 85.7% favored 8.7% allowed 2.4% week 3.2% disallowed Occluded: Model structure: H1HW36_occluded.pdb Alignment file: H1HW36_occ.pir Procheck score ⇒ Ramachandran plot: 86.5% favored 8.7% allowed 4.0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA