| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : H1HMJ9
dbSWEET id: dbswt_1805
Accession: H1HMJ9
Uniprot status: Unreviewed
Organism: Prevotella maculosa
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|H1HMJ9|H1HMJ9_9BACT|Unreviewed|Prevotella maculosa|86
MTREKFFGAMGWVGMGTSVLMYVFYLPQIENNLAGQKGTFIQPFMAAVNCTLWVAYGLFK
EKRDLPLAIANTPGIIFGLIAAFTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: H1HMJ9_inward.pdb Alignment file: H1HMJ9_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 9.5% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: H1HMJ9_outward.pdb Alignment file: H1HMJ9_out.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 8.7% allowed .0% week .0% disallowed Occluded: Model structure: H1HMJ9_occluded.pdb Alignment file: H1HMJ9_occ.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 5.6% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA