Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : H1HC70
dbSWEET id: dbswt_1804
Accession: H1HC70
Uniprot status: Unreviewed
Organism: Fusobacterium nucleatum
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|H1HC70|H1HC70_FUSNU|Unreviewed|Fusobacterium nucleatum|85
MTEKQTKIIGWMGTTLSILMYVSYIPQIIGNLNGNKTSFIQPLVAAINCTIWVSYGLFKK
DRDFPLAFANLPGIIFGLIAAFTAM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: H1HC70_inward.pdb Alignment file: H1HC70_inw.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 7.0% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: H1HC70_outward.pdb Alignment file: H1HC70_out.pir Procheck score ⇒ Ramachandran plot: 88.3% favored 10.2% allowed .8% week .8% disallowed Occluded: Model structure: H1HC70_occluded.pdb Alignment file: H1HC70_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.8% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA