Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : H0X9W7
dbSWEET id: dbswt_1188
Accession: H0X9W7
Uniprot status: Unreviewed
Organism: Otolemur garnettii
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Primates ⇒ Strepsirrhini ⇒ Lorisiformes ⇒ Galagidae ⇒ Otolemur.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|H0X9W7|H0X9W7_OTOGA|Unreviewed|Otolemur_garnettii|221
METGGVFDSLLSGVCVVFTLGMFSTGLSDLRHMWMTRSVDSVQFLPFLTTEVNNLGWLSY
GTLKGDGTLIVVNAVGAVLQTLYISAYLHYCPRKRAVLLQTATLLGILLLGYGYFGLLVP
DPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSFSLTIATLLTSVSWSLYGF
RLRDPYIMVPNIPGILTSFIRLWLFWKYPQEQDRNYRLLQT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: H0X9W7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: H0X9W7_inward.pdb
Procheck score ⇒ Ramachandran plot: 87.9% favored 8.8% allowed 2.2% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: H0X9W7_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.7% favored 8.2% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: H0X9W7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 5.5% allowed 2.7% week .5% disallowed
Gene Informationback to top
Gene ID: 100961241 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0042947 - glucoside transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0045815 - positive regulation of gene expression epigenetic
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA