Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : H0X9W7

dbSWEET id: dbswt_1188

Accession:   H0X9W7

Uniprot status:   Unreviewed

Organism:   Otolemur garnettii

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Primates ⇒ Strepsirrhini ⇒ Lorisiformes ⇒ Galagidae ⇒ Otolemur.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|H0X9W7|H0X9W7_OTOGA|Unreviewed|Otolemur_garnettii|221
METGGVFDSLLSGVCVVFTLGMFSTGLSDLRHMWMTRSVDSVQFLPFLTTEVNNLGWLSY
GTLKGDGTLIVVNAVGAVLQTLYISAYLHYCPRKRAVLLQTATLLGILLLGYGYFGLLVP
DPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSFSLTIATLLTSVSWSLYGF
RLRDPYIMVPNIPGILTSFIRLWLFWKYPQEQDRNYRLLQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: H0X9W7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  H0X9W7_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.9% favored    8.8% allowed    2.2% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  H0X9W7_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.7% favored    8.2% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  H0X9W7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    5.5% allowed    2.7% week    .5% disallowed

Gene Informationback to top


Gene ID:   100961241     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur