Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G9WPJ5

dbSWEET id: dbswt_1801

Accession:   G9WPJ5

Uniprot status:   Unreviewed

Organism:   Oribacterium parvum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Oribacterium.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CPCP           CVV:   352       CHI:   1.8

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|G9WPJ5|G9WPJ5_9FIRM|Unreviewed|Oribacterium parvum|87
MSKKKINLFVGSIGAFLGIFVFIAYIPQIYANLQGSKAQPFQPLFAAISCLIWVIYGWTK
EPKKDWILIIPNSAGVILGGLTFLTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  G9WPJ5_inward.pdb    Alignment file: G9WPJ5_inw.pir

Procheck score ⇒ Ramachandran plot: 83.9% favored    12.1% allowed    1.6% week    2.4% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  G9WPJ5_outward.pdb    Alignment file: G9WPJ5_out.pir

Procheck score ⇒ Ramachandran plot: 87.1% favored    10.5% allowed    .8% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  G9WPJ5_occluded.pdb    Alignment file: G9WPJ5_occ.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    8.1% allowed    1.6% week    2.4% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur