Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : G9WPJ5
dbSWEET id: dbswt_1801
Accession: G9WPJ5
Uniprot status: Unreviewed
Organism: Oribacterium parvum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Oribacterium.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CPCP CVV: 352 CHI: 1.8
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|G9WPJ5|G9WPJ5_9FIRM|Unreviewed|Oribacterium parvum|87
MSKKKINLFVGSIGAFLGIFVFIAYIPQIYANLQGSKAQPFQPLFAAISCLIWVIYGWTK
EPKKDWILIIPNSAGVILGGLTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: G9WPJ5_inward.pdb Alignment file: G9WPJ5_inw.pir Procheck score ⇒ Ramachandran plot: 83.9% favored 12.1% allowed 1.6% week 2.4% disallowed Outward Open: Template: 4X5N.pdb Model structure: G9WPJ5_outward.pdb Alignment file: G9WPJ5_out.pir Procheck score ⇒ Ramachandran plot: 87.1% favored 10.5% allowed .8% week 1.6% disallowed Occluded: Model structure: G9WPJ5_occluded.pdb Alignment file: G9WPJ5_occ.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 8.1% allowed 1.6% week 2.4% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA