Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G9PGS8

dbSWEET id: dbswt_1800

Accession:   G9PGS8

Uniprot status:   Unreviewed

Organism:   Actinomyces graevenitzii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Actinomycetales ⇒ Actinomycetaceae ⇒ Actinomyces.

Sequence Information back to top


Sequence length:   112

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|G9PGS8|G9PGS8_9ACTO|Unreviewed|Actinomyces graevenitzii| 112
MSKQAESSKDEKNAQAASEPEVRSGLALTVKQEKVLGWVATFMAVCMYVAYVPQIVSNLN
GQAGNPLQPLVAAINCSLWVYYGLFKPSRDLPLAAANAPGIFFGLAAFVTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   37     Model end:   113

Inward Open:

Template:   4X5M.pdb

Model structure:  G9PGS8_inward.pdb    Alignment file: G9PGS8_inw.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    7.9% allowed    .8% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  G9PGS8_outward.pdb    Alignment file: G9PGS8_out.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    7.1% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  G9PGS8_occluded.pdb    Alignment file: G9PGS8_occ.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur