| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : G8PDK4
dbSWEET id: dbswt_1799
Accession: G8PDK4
Uniprot status: Unreviewed
Organism: Pediococcus claussenii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Pediococcus.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|G8PDK4|G8PDK4_PEDCP|Unreviewed|Pediococcus claussenii|88
MKQESISIKIIGRLASFLSVLMYVSYIPQIFANLNGSYGNPIQPLVAGINCTVWTYYGLF
KANRDWPIVIANLPGIVLGFFTFFTALH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: G8PDK4_inward.pdb Alignment file: G8PDK4_inw.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 10.3% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: G8PDK4_outward.pdb Alignment file: G8PDK4_out.pir Procheck score ⇒ Ramachandran plot: 88.9% favored 9.5% allowed 1.6% week .0% disallowed Occluded: Model structure: G8PDK4_occluded.pdb Alignment file: G8PDK4_occ.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 6.3% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA