Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : G7ZV40
dbSWEET id: dbswt_627
Accession: G7ZV40
Uniprot status: Unreviewed
Organism: Medicago truncatula
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.
Sequence Information back to top
Sequence length: 235
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|G7ZV40|G7ZV40_MEDTR|Unreviewed|Medicago_truncatula|235
MSLFNAYSICEIGKDAAGIAGNIFAFGLFVSPIPTFRRIMRNGSTELFSGLPYIYSLLNC
LICLWYGTPLISCDNLLVTTVNSIGAAFQLVYIFLFLIYAEKPKKVRMFGLLLAVLGIFV
IILVGSLKITDSSIRRILVGCLSCASLISMFASPLFIIKLVIRTKSVEFMPFYLSFSTFL
MSISFFLYGLLSDDAFIYVPNGIGTVLGMIQLILYFYYKRSSSDDSTEPLIVSYG
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 219
Alignment file: G7ZV40.pir
Inward Open:
Template: 5CTG.pdb
Model structure: G7ZV40_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: G7ZV40_outward.pdb
Procheck score ⇒ Ramachandran plot: 88.9% favored 8.7% allowed 2.4% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: G7ZV40_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 7.2% allowed 1.0% week 1.4% disallowed
Gene Informationback to top
Gene ID: 25501110 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA