| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : G7J6S1
dbSWEET id: dbswt_562
Accession: G7J6S1
Uniprot status: Unreviewed
Organism: Medicago truncatula
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.
Sequence Information back to top
Sequence length: 250
Substrate Binding Site: CNWS CVV: 418 CHI: -2.7
Selectivity Filter: LNLA CVV: 411 CHI: 5.9
Fasta sequence:
>tr|G7J6S1|G7J6S1_MEDTR|Unreviewed|Medicago_truncatula|250
MSNTLRLAVAVLGNAASVSLYAAPMVTFKRVIRKKSTEEFSCIPYIIGLLNCLLFTWYGL
PIVSYKWENFPLVTVNGVGIALELSYVLIYFWYSSPKGKVKVAMITTPVLLVFCITVAVS
TFFLHDTTHRKLLVGSIGLVVSVALYGSPLVAMKKVIQTKSVEFMPLPLSLCAFSASVFW
LAYGILVRDVFVAGPSLVGTPLSILQLVIYFKYRKERVMEESKIGDLEKGSIELEKVVKV
EKIVTNCEQC
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: G7J6S1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: G7J6S1_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 4.2% allowed 2.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: G7J6S1_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.8% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: G7J6S1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 4.8% allowed 1.1% week 1.1% disallowed
Gene Informationback to top
Gene ID: 11441463 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA