Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G7J6S0

dbSWEET id: dbswt_563

Accession:   G7J6S0

Uniprot status:   Unreviewed

Organism:   Medicago truncatula

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.

Sequence Information back to top


Sequence length:   250

Substrate Binding Site:   CNWS           CVV:   418       CHI:   -2.7

Selectivity Filter:   LNLA           CVV:   411       CHI:   5.9

Fasta sequence:

>tr|G7J6S0|G7J6S0_MEDTR|Unreviewed|Medicago_truncatula|250
MSETLRLAVAVLGNAASVSLYAAPMVTFKRVIRKKSTEEFSCIPYIIGLLNCLLFTWYGL
PIVSYKWENFPLVTVNGVGIALELSYVLIYFWYSSPKGKVKVAMIMTPVLLVFCIVAAVS
AFSFHDTAHRKLLVGSIGLGVSVALYGSPLVAMKKVIETKSVEFMPLPLSLCAFSASACW
LVYGILVRDVFVAGPSVVGTPLSILQLVVYFKYRKARVVEEQKIGDLEKGSIELEKVVKV
EKIVTNCEQC

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: G7J6S0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  G7J6S0_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    4.8% allowed    2.1% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  G7J6S0_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.0% favored    6.9% allowed    1.1% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  G7J6S0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.4% favored    8.0% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Gene ID:   11414337     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur