Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G7J3C8

dbSWEET id: dbswt_400

Accession:   G7J3C8

Uniprot status:   Unreviewed

Organism:   Medicago truncatula

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.

Sequence Information back to top


Sequence length:   311

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   CSVS           CVV:   337       CHI:   5.1

Fasta sequence:

>tr|G7J3C8|G7J3C8_MEDTR|Unreviewed|Medicago_truncatula|311
MSSHHSHLSFAFGVLGNISSFVCFLAPLPTFYRICKKKSTEGFQSIPYVAALFSAMLWMF
YAYTKKGETLLITINAFGCVIETIYLAVFVTYCPKKVRMSTLRMIVLMNFVGFGTIVLLT
HFLAKQEEGRIKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSVLLLISAVMW
LLYGLSLRDIYVTLPNVVGLTFGIVQITLYAMYRNSKPVIDEKLPEHKGDIVDKEIENVV
VPSKTTNDEKKLEVSVVDMVIVEKKEEKQDEEHDEKEKKQDQVTQDKTKVKNENDNININ
KTEEKDSGCEV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   215

Alignment file: G7J3C8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  G7J3C8_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    .5% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  G7J3C8_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    6.8% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  G7J3C8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.1% favored    7.3% allowed    1.6% week    1.0% disallowed

Gene Informationback to top


Gene ID:   11431164     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur