| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : G6ADY3
dbSWEET id: dbswt_1798
Accession: G6ADY3
Uniprot status: Unreviewed
Organism: Prevotella histicola
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|G6ADY3|G6ADY3_9BACT|Unreviewed|Prevotella histicola|86
MTKEKFFTAMGWVGMVTAVLMYVFYLPQIESNLAGNKGSFIQPFMAGVNCTLWVAYGLFK
EKRDWPVAIANTPGIIFGFVAAFTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: G6ADY3_inward.pdb Alignment file: G6ADY3_inw.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: G6ADY3_outward.pdb Alignment file: G6ADY3_out.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed Occluded: Model structure: G6ADY3_occluded.pdb Alignment file: G6ADY3_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 6.3% allowed 3.2% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA