Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G5GZY4

dbSWEET id: dbswt_1797

Accession:   G5GZY4

Uniprot status:   Unreviewed

Organism:   Selenomonas noxia

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.

Sequence Information back to top


Sequence length:   111

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|G5GZY4|G5GZY4_9FIRM|Unreviewed|Selenomonas noxia| 111
MAELLKKTEAEAEHLEKEAAQLGKGAMQNKMKIVGAIASGLSICMYVSYIPQIIGNLSGH
QGDWIQPSVAFINCTMWVAYGFFREHREWPLVLANLPGIVFGLTAAITARM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   35     Model end:   111

Inward Open:

Template:   4X5M.pdb

Model structure:  G5GZY4_inward.pdb    Alignment file: G5GZY4_inw.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.1% allowed    .0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  G5GZY4_outward.pdb    Alignment file: G5GZY4_out.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    7.9% allowed    .0% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  G5GZY4_occluded.pdb    Alignment file: G5GZY4_occ.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    4.8% allowed    2.4% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur