| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : G5EPU2
dbSWEET id: dbswt_1795
Accession: G5EPU2
Uniprot status: Unreviewed
Organism: Rothia mucilaginosa
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 112
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|G5EPU2|G5EPU2_9MICC|Unreviewed|Rothia mucilaginosa| 112
MAEQNNSSSTTPKNTAEKSGMSAESEFHAKFFPILARVASVTAVLMYVFYFPQIIGNLNG
HKGDWIQPLVAAVNCTLWLLYGLWRPKKDVPIIIANAPGILFGGLAAITALI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 36 Model end: 112 Inward Open: Template: 4X5M.pdb Model structure: G5EPU2_inward.pdb Alignment file: G5EPU2_inw.pir Procheck score ⇒ Ramachandran plot: 90.3% favored 8.1% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: G5EPU2_outward.pdb Alignment file: G5EPU2_out.pir Procheck score ⇒ Ramachandran plot: 95.2% favored 2.4% allowed .8% week 1.6% disallowed Occluded: Model structure: G5EPU2_occluded.pdb Alignment file: G5EPU2_occ.pir Procheck score ⇒ Ramachandran plot: 89.5% favored 8.1% allowed 2.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA