Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G5EPU2

dbSWEET id: dbswt_1795

Accession:   G5EPU2

Uniprot status:   Unreviewed

Organism:   Rothia mucilaginosa

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Micrococcales ⇒ Micrococcaceae ⇒ Rothia.

Sequence Information back to top


Sequence length:   112

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|G5EPU2|G5EPU2_9MICC|Unreviewed|Rothia mucilaginosa| 112
MAEQNNSSSTTPKNTAEKSGMSAESEFHAKFFPILARVASVTAVLMYVFYFPQIIGNLNG
HKGDWIQPLVAAVNCTLWLLYGLWRPKKDVPIIIANAPGILFGGLAAITALI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   36     Model end:   112

Inward Open:

Template:   4X5M.pdb

Model structure:  G5EPU2_inward.pdb    Alignment file: G5EPU2_inw.pir

Procheck score ⇒ Ramachandran plot: 90.3% favored    8.1% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  G5EPU2_outward.pdb    Alignment file: G5EPU2_out.pir

Procheck score ⇒ Ramachandran plot: 95.2% favored    2.4% allowed    .8% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  G5EPU2_occluded.pdb    Alignment file: G5EPU2_occ.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.1% allowed    2.4% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur