Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : G4A7Q9
dbSWEET id: dbswt_2011
Accession: G4A7Q9
Uniprot status: Unreviewed
Organism: Aggregatibacter actinomycetemcomita
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Pasteurellales ⇒ Pasteurellaceae ⇒ Aggregatibacter.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|G4A7Q9|G4A7Q9_AGGAC|Unreviewed|Aggregatibacter actinomycetemcomita|86
MTNQRFITILSWVATFTAVCMYVSYLEQIGMNLDGVKGGTLQPLATAINCSLWVAYGLLK
KERDYPVALANSPGVILGLISFATAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: G4A7Q9_inward.pdb Alignment file: G4A7Q9_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 8.6% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: G4A7Q9_outward.pdb Alignment file: G4A7Q9_out.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed .8% week .8% disallowed Occluded: Model structure: G4A7Q9_occluded.pdb Alignment file: G4A7Q9_occ.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 5.5% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA