Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G3VYH1

dbSWEET id: dbswt_1185

Accession:   G3VYH1

Uniprot status:   Unreviewed

Organism:   Sarcophilus harrisii

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Metatheria ⇒ Dasyuromorphia ⇒ Dasyuridae ⇒ Sarcophilus.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMA           CVV:   411       CHI:   2.1

Fasta sequence:

>tr|G3VYH1|G3VYH1_SARHA|Unreviewed|Sarcophilus_harrisii|221
MEAAAAPDALLSGACVLFTLCMFSTGLSDLRHMQTTRSVNNIQFLPFLTTDVNNLSWLSY
GLLKGDKTLVVVNSVGALLQTLYIVTYLRYCPRKRTVLLQTAALLGLLLLGYTYFQLLVP
DWTSRLRQLGLFCSIFTISMYLSPLADLAKIIQTKSTQCLSFSLTVATLLASASWTLYGL
HLRDLYIMVPNIPGILTSLVRLGLFWQYPQVQEKNYSLLQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: G3VYH1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  G3VYH1_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.8% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  G3VYH1_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.5% favored    9.0% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  G3VYH1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    7.4% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur