| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : G3PE71
dbSWEET id: dbswt_1184
Accession: G3PE71
Uniprot status: Unreviewed
Organism: Gasterosteus aculeatus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Actinopterygii ⇒ Neopterygii ⇒ Teleostei ⇒ Neoteleostei ⇒ Acanthomorphata ⇒ Eupercaria ⇒ Perciformes ⇒ Cottioidei ⇒ Gasterosteales ⇒ Gasterosteidae ⇒ Gasterosteus.
Sequence Information back to top
Sequence length: 225
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|G3PE71|G3PE71_GASAC|Unreviewed|Gasterosteus_aculeatus|225
LFSGFSMDSIHLLSWACIVFTVGMFSTGLTDLKKMKESKSAENIQFLPFLTTCLNNLGWL
YYGLLKTDRTIVLVNVIGALLQVLYIIVYLHYTKQKRLVMTQTAAAGTVLTCAWFYFTTY
LPEGDTRLSQLGLTCSVVTVSMYLSPLTDLVQIVRSGDVTCLSFPLTVATFFTSTSWVLY
GLQLNDYFIVVPNTPGILTSLIRFYLFWRFASVNQSSPAYKSMHI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 212
Alignment file: G3PE71.pir
Inward Open:
Template: 5CTG.pdb
Model structure: G3PE71_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 7.9% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: G3PE71_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.0% favored 7.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: G3PE71_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.4% favored 9.0% allowed .5% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA