Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : G3HC55
dbSWEET id: dbswt_1183
Accession: G3HC55
Uniprot status: Unreviewed
Organism: Cricetulus griseus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Glires ⇒ Rodentia ⇒ Sciurognathi ⇒ Muroidea ⇒ Cricetidae ⇒ Cricetinae ⇒ Cricetulus.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMS CVV: 417 CHI: -0.5
Fasta sequence:
>tr|G3HC55|G3HC55_CRIGR|Unreviewed|Cricetulus_griseus|221
MEAGGVADSFLSGACVLFTLGMFSTGLSDLRHMQRTRSVDSIQFLPFLTTDVNNLGWLSY
GVLKGDGTLIIVNIVGAVLQTLYILAYLHYSPQKHAVLLQTAALLGVLLLGYGYFWLLVP
DLEARLQQLGLFCSVFTISMYLSPLADLAKIIQTKSTQRLSFSLTIATFLSSTSWSIYGF
RLRDPYITVPNLPGIITSLIRLGLFCKYPPEHDRKYRLLQT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: G3HC55.pir
Inward Open:
Template: 5CTG.pdb
Model structure: G3HC55_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 4.9% allowed 1.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: G3HC55_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 6.0% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: G3HC55_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.7% favored 7.7% allowed .5% week 1.1% disallowed
Gene Informationback to top
Gene ID: 100757783 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA