Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : G1WCE8
dbSWEET id: dbswt_1792
Accession: G1WCE8
Uniprot status: Unreviewed
Organism: Prevotella oulorum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|G1WCE8|G1WCE8_9BACT|Unreviewed|Prevotella oulorum|86
MTKEKFFEKLGWIGMMTSVLMYVFYIAQIQNNLSGQKGTFIQPLMAAINCTLWVCYGLFK
EKRDLPLALANAPGIIFGLITAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: G1WCE8_inward.pdb Alignment file: G1WCE8_inw.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 9.2% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: G1WCE8_outward.pdb Alignment file: G1WCE8_out.pir Procheck score ⇒ Ramachandran plot: 86.2% favored 10.8% allowed 2.3% week .8% disallowed Occluded: Model structure: G1WCE8_occluded.pdb Alignment file: G1WCE8_occ.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 6.9% allowed .0% week 2.3% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA