Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G1P1X3

dbSWEET id: dbswt_1181

Accession:   G1P1X3

Uniprot status:   Unreviewed

Organism:   Myotis lucifugus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Chiroptera ⇒ Microchiroptera ⇒ Vespertilionidae ⇒ Myotis.

Sequence Information back to top


Sequence length:   220

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|G1P1X3|G1P1X3_MYOLU|Unreviewed|Myotis_lucifugus|220
MEAGAADALLSGVCVVFTLGMFSTGLSDLRHMWMTRRVDSVQFLPFLTTDVNNLSWLGYG
TLKGDGTLIVVNAVGAVLQTLYILVYLHYCPRKGVELLQTAALLGVLLLGFGYFWLLVPN
IEARLQQLGLFCSVFTISMYLSPLTDLARVIQTKSTQRLSFSLTIATLLTSASWTLYGFR
LSDPYIMVPNVPGILTSFIRLWLFWKYPQEQDRNYQLLQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   209

Alignment file: G1P1X3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  G1P1X3_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.7% favored    7.1% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  G1P1X3_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    4.9% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  G1P1X3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.7% favored    7.7% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   102428094     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur