Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G0UF81

dbSWEET id: dbswt_2010

Accession:   G0UF81

Uniprot status:   Unreviewed

Organism:   Weissella thailandensis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Weissella.

Sequence Information back to top


Sequence length:   105

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   SDSD           CVV:   328       CHI:   -8.6

Fasta sequence:

>tr|G0UF81|G0UF81_9LACT|Unreviewed|Weissella thailandensis| 105
MDSGTDKSSDRRRFIDLSSRVTIVRLISILATIMCVLMYLSYITEIQSNLAGNPVPLVQP
LTMMLDAMLWAGYGWLKKYRDWPLVISNVPGIFLGILTIITIYVH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   28     Model end:   104

Inward Open:

Template:   4X5M.pdb

Model structure:  G0UF81_inward.pdb    Alignment file: G0UF81_inw.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    8.6% allowed    2.3% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  G0UF81_outward.pdb    Alignment file: G0UF81_out.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.8% allowed    .8% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  G0UF81_occluded.pdb    Alignment file: G0UF81_occ.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.5% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur