Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G0PEB9

dbSWEET id: dbswt_1179

Accession:   G0PEB9

Uniprot status:   Unreviewed

Organism:   Caenorhabditis brenneri

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   QNWN           CVV:   469       CHI:   -11.4

Selectivity Filter:   FIGL           CVV:   431       CHI:   10.7

Fasta sequence:

>tr|G0PEB9|G0PEB9_CAEBE|Unreviewed|Caenorhabditis_brenneri|221
MFLKLYTAWLGLFSVSFLFLPIYLVLDWRKRGTAEGFSSVVLIIPGIIQSFWLRHAWMNN
DWSNVLINTLNLTFLTFYIAVYAYYQPKRKYLIGQLIGAAFIVQCAFYYVDAHDPEDMSA
AMGTVAAGAQILGLGGRIYEIRRAIKMGTTEYIPAVMQFAVATLMAQWFIFRVVTGNKFI
AIANIAGLLTSAFTMYLYFRYPPLTWTVPIFNIPPQQKKEE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   203

Alignment file: G0PEB9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  G0PEB9_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.4% favored    11.0% allowed    .0% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  G0PEB9_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    8.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  G0PEB9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    7.7% allowed    .6% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018175: SWEET_nem. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF4:

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur