Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G0NPU3

dbSWEET id: dbswt_1176

Accession:   G0NPU3

Uniprot status:   Unreviewed

Organism:   Caenorhabditis brenneri

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   229

Substrate Binding Site:   SQAN           CVV:   350       CHI:   -6

Selectivity Filter:   LGSM           CVV:   344       CHI:   4.9

Fasta sequence:

>tr|G0NPU3|G0NPU3_CAEBE|Unreviewed|Caenorhabditis_brenneri|229
MELDLGTVSASRLFAMYTSNLVWSLFLTSTALHAVALITSPVQAVYKWVRRQSSDSDTPI
PYICAVIGSALWLRYSIFIRDTKLILLQTYAVSMQLFFVVALIFYRTKRRKLIRLMTGIA
AAMSLLFLYIDNLNDEDGKEFTGRIASGAQIAGSLVCPYLIYKAVTSKCIDFVPLAPVVF
TWVMELHAIVYSIGIDDFYMLLANVIFFCMDGSLLSMFFVYPTEKKKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   16     Model end:   223

Alignment file: G0NPU3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  G0NPU3_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.0% favored    8.9% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  G0NPU3_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    7.9% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  G0NPU3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.1% favored    6.8% allowed    2.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur