Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G0NG17

dbSWEET id: dbswt_1175

Accession:   G0NG17

Uniprot status:   Unreviewed

Organism:   Caenorhabditis brenneri

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   356

Substrate Binding Site:   GQWN           CVV:   400       CHI:   -5.5

Selectivity Filter:   LGDV           CVV:   368       CHI:   4.1

Fasta sequence:

>tr|G0NG17|G0NG17_CAEBE|Unreviewed|Caenorhabditis_brenneri|356
MFEIFTQGFSFLNLLSILAFFTTVGLFFCGIPICRQIWKRKDTKEISGAPFLMGVVGGCC
WMTYGWLKNDGTVKWVTGCQVILYTTYTIFYWCMTKKKLWISLKVLGVIGICTSLVLGVH
FFGMKIFHPLGIVCLTLNIADFAAPLGGIRVVIRRWATSTLPLPLCIANFLVSSEWFLYG
LLKNDFYLIFPNGVGSLLAFIQLLLFIVLPRKPGQRAPLVMLWMWIRGVKIEETKEIVAE
LGECEEKKMNRAQRWSQKIKMNVSTVAEELENVIYNLPTKDQFAYTHKIGDDDSSSEKTV
ETTEEPKKTSASPAIPAIEAVKDSEFERKMRNSLRAAQEAREATLRRTISSPDLSD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   211

Alignment file: G0NG17.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  G0NG17_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    5.6% allowed    1.7% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  G0NG17_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.9% favored    4.5% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  G0NG17_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.1% favored    10.7% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur