Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : G0MS83

dbSWEET id: dbswt_1174

Accession:   G0MS83

Uniprot status:   Unreviewed

Organism:   Caenorhabditis brenneri

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   217

Substrate Binding Site:   QNSF           CVV:   418       CHI:   -5

Selectivity Filter:   FVMF           CVV:   499       CHI:   11.7

Fasta sequence:

>tr|G0MS83|G0MS83_CAEBE|Unreviewed|Caenorhabditis_brenneri|217
MLLEIFTVWLGLFSIGFTFLPMYMVLDWRKRGTADGFSSVNFVLPMLVQSFWLRHGFMTN
DQTNIIINSINLVFFAFYVSAFAYYQPKRKYLIGQIVAALLAIKLAFSYVDTHDADSIND
AMGSMAAGAQIFSLKRAISMGTTEYIPAGFQFAIFTLILQWLLFGILHGNQFIAISNAAG
LLVNIATLALYFFYPPLTWTVPIFNIPPQNKDAKKVE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: G0MS83.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  G0MS83_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.1% favored    11.3% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  G0MS83_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    8.1% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  G0MS83_occluded.pdb

Procheck score ⇒ Ramachandran plot: 87.6% favored    10.8% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur