| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F9USZ5
dbSWEET id: dbswt_1790
Accession: F9USZ5
Uniprot status: Unreviewed
Organism: Lactobacillus plantarum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: GNGN CVV: 288 CHI: -7.8
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|F9USZ5|F9USZ5_LACPL|Unreviewed|Lactobacillus plantarum|90
MDPKRVKYLKLISKLATFTCIAMYVSYIPQIISNFSGDPVSPLQPLVAMINGILWTGYGW
FKTYKDWPVIISNVPGVIFGFITVLTVYIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 13 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: F9USZ5_inward.pdb Alignment file: F9USZ5_inw.pir Procheck score ⇒ Ramachandran plot: 93.5% favored 4.0% allowed 2.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: F9USZ5_outward.pdb Alignment file: F9USZ5_out.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 8.9% allowed 2.4% week .8% disallowed Occluded: Model structure: F9USZ5_occluded.pdb Alignment file: F9USZ5_occ.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 10.5% allowed .0% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA