Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F9USZ5

dbSWEET id: dbswt_1790

Accession:   F9USZ5

Uniprot status:   Unreviewed

Organism:   Lactobacillus plantarum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   GNGN           CVV:   288       CHI:   -7.8

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|F9USZ5|F9USZ5_LACPL|Unreviewed|Lactobacillus plantarum|90
MDPKRVKYLKLISKLATFTCIAMYVSYIPQIISNFSGDPVSPLQPLVAMINGILWTGYGW
FKTYKDWPVIISNVPGVIFGFITVLTVYIH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   89

Inward Open:

Template:   4X5M.pdb

Model structure:  F9USZ5_inward.pdb    Alignment file: F9USZ5_inw.pir

Procheck score ⇒ Ramachandran plot: 93.5% favored    4.0% allowed    2.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F9USZ5_outward.pdb    Alignment file: F9USZ5_out.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    8.9% allowed    2.4% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F9USZ5_occluded.pdb    Alignment file: F9USZ5_occ.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    10.5% allowed    .0% week    1.6% disallowed

Gene Informationback to top


Gene ID:   1061451

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur