Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : F9PDH9
dbSWEET id: dbswt_1787
Accession: F9PDH9
Uniprot status: Unreviewed
Organism: Streptococcus infantis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|F9PDH9|F9PDH9_9STRE|Unreviewed|Streptococcus infantis|88
MKITEKQMKMLGWVATFMSVMMYMSYFPQIMDNLAGQKGNFIEPLVAAINCSLWVYYGLF
KKERDIPLAAANAPGIIFGLVTAITALI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: F9PDH9_inward.pdb Alignment file: F9PDH9_inw.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 9.2% allowed .0% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: F9PDH9_outward.pdb Alignment file: F9PDH9_out.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 7.7% allowed .8% week 1.5% disallowed Occluded: Model structure: F9PDH9_occluded.pdb Alignment file: F9PDH9_occ.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 4.6% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA