Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F9EQ65

dbSWEET id: dbswt_1784

Accession:   F9EQ65

Uniprot status:   Unreviewed

Organism:   Fusobacterium nucleatum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Fusobacteria ⇒ Fusobacteriales ⇒ Fusobacteriaceae ⇒ Fusobacterium.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|F9EQ65|F9EQ65_FUSNU|Unreviewed|Fusobacterium nucleatum|85
MTEKQSKIFGYLGSTLSILMYVSYIPQIMGNLSGHKTSFVQPLVATVNCTIWVIYGLFKK
NKDLPIIFANLPGIIFGLIATITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  F9EQ65_inward.pdb    Alignment file: F9EQ65_inw.pir

Procheck score ⇒ Ramachandran plot: 89.1% favored    9.4% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F9EQ65_outward.pdb    Alignment file: F9EQ65_out.pir

Procheck score ⇒ Ramachandran plot: 86.7% favored    10.9% allowed    2.3% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F9EQ65_occluded.pdb    Alignment file: F9EQ65_occ.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    10.2% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur