| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F9DKU9
dbSWEET id: dbswt_1783
Accession: F9DKU9
Uniprot status: Unreviewed
Organism: Prevotella pallens
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|F9DKU9|F9DKU9_9BACT|Unreviewed|Prevotella pallens|86
MTKEKFFEAMGWVGMVTSILMYVFYFPQIWNNLHGHKGIFIQPFMAGVNCTLWVCYGLFK
EKRDWALAIANTPGIILGFIAAFTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: F9DKU9_inward.pdb Alignment file: F9DKU9_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 3.9% allowed .8% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: F9DKU9_outward.pdb Alignment file: F9DKU9_out.pir Procheck score ⇒ Ramachandran plot: 95.3% favored 4.7% allowed .0% week .0% disallowed Occluded: Model structure: F9DKU9_occluded.pdb Alignment file: F9DKU9_occ.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA