| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F9DE62
dbSWEET id: dbswt_1782
Accession: F9DE62
Uniprot status: Unreviewed
Organism: Prevotella nigrescens
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|F9DE62|F9DE62_9BACT|Unreviewed|Prevotella nigrescens|86
MTKEKFFGGMGWAGMVTSILMYVFYFPQILNNLDGHKGTFIQPFMAGINCTLWVCYGFFK
EKRDWPLVIANVPGIIFGFVAAFTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: F9DE62_inward.pdb Alignment file: F9DE62_inw.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 11.9% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: F9DE62_outward.pdb Alignment file: F9DE62_out.pir Procheck score ⇒ Ramachandran plot: 84.9% favored 11.9% allowed .8% week 2.4% disallowed Occluded: Model structure: F9DE62_occluded.pdb Alignment file: F9DE62_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA