Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F9DE62

dbSWEET id: dbswt_1782

Accession:   F9DE62

Uniprot status:   Unreviewed

Organism:   Prevotella nigrescens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|F9DE62|F9DE62_9BACT|Unreviewed|Prevotella nigrescens|86
MTKEKFFGGMGWAGMVTSILMYVFYFPQILNNLDGHKGTFIQPFMAGINCTLWVCYGFFK
EKRDWPLVIANVPGIIFGFVAAFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  F9DE62_inward.pdb    Alignment file: F9DE62_inw.pir

Procheck score ⇒ Ramachandran plot: 87.3% favored    11.9% allowed    .0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F9DE62_outward.pdb    Alignment file: F9DE62_out.pir

Procheck score ⇒ Ramachandran plot: 84.9% favored    11.9% allowed    .8% week    2.4% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F9DE62_occluded.pdb    Alignment file: F9DE62_occ.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur