Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F8NCM7

dbSWEET id: dbswt_1780

Accession:   F8NCM7

Uniprot status:   Unreviewed

Organism:   Prevotella multisaccharivorax

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   MNMN           CVV:   440       CHI:   -3.2

Fasta sequence:

>tr|F8NCM7|F8NCM7_9BACT|Unreviewed|Prevotella multisaccharivorax|86
MTKEKFFTNLGWVGMVTSVLMYVFYIAQIQNNLAGQKGTFIQPFMAAINCTLWVCYGLFK
EKRDLPLALANAPGVVFGLITAFTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   8     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  F8NCM7_inward.pdb    Alignment file: F8NCM7_inw.pir

Procheck score ⇒ Ramachandran plot: 88.8% favored    9.0% allowed    .7% week    1.5% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F8NCM7_outward.pdb    Alignment file: F8NCM7_out.pir

Procheck score ⇒ Ramachandran plot: 87.3% favored    11.2% allowed    .0% week    1.5% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F8NCM7_occluded.pdb    Alignment file: F8NCM7_occ.pir

Procheck score ⇒ Ramachandran plot: 93.3% favored    4.5% allowed    2.2% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur