Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : F7D9S0
dbSWEET id: dbswt_1172
Accession: F7D9S0
Uniprot status: Unreviewed
Organism: Equus caballus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Perissodactyla ⇒ Equidae ⇒ Equus.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMA CVV: 411 CHI: 2.1
Fasta sequence:
>tr|F7D9S0|F7D9S0_HORSE|Unreviewed|Equus_caballus|221
MEAGGVADSLLSGACVLFTLGMFSSGLSDLRHMRMTRSVDNVQFLPFLTTDINNLSWLSY
GALKGDGTLIIVNSVGAMLQTLYILVYLHYCPRKRGVLLQTAALLGVLLLGFGYFWLLVP
DLEARLQWLGLFCSVFTISMYLSPLADLAKVIQTKSAQHFSFSLTIATLLASASWTLYGF
RLKDPYITVPNFPGIVTSFIRLWLFWKYSQKPARNSQLLQT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: F7D9S0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: F7D9S0_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 4.9% allowed 1.1% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: F7D9S0_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.2% favored 7.6% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: F7D9S0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.2% favored 6.0% allowed 3.3% week .5% disallowed
Gene Informationback to top
Gene ID: 100057221 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0042947 - glucoside transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0045815 - positive regulation of gene expression epigenetic
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA