Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : F6WJ76
dbSWEET id: dbswt_1171
Accession: F6WJ76
Uniprot status: Unreviewed
Organism: Ciona intestinalis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Tunicata ⇒ Ascidiacea ⇒ Enterogona ⇒ Phlebobranchia ⇒ Cionidae ⇒ Ciona.
Sequence Information back to top
Sequence length: 222
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: LSNV CVV: 398 CHI: 3.7
Fasta sequence:
>tr|F6WJ76|F6WJ76_CIOIN|Unreviewed|Ciona_intestinalis|222
MDWGVVEIVSFVATVTNVLLFLSGIQIISKIYTRGSSQGFSVLPFIVCFVSSTLWTKYGL
LSEDSIMILVNFIGVVIEGFYTAVFYLNTKQKQKKLQMTIFSLLAFMFAVLIYTKYFVNQ
DLALKHHGFICAAFNIINYAAPLSSAAVVIRKKSTENLSLLLSVVYFLVSVEWFFYGYLH
QDNFIMIPNTLGILFCSFQLSLFVFYPSKRTISDHKPDIVTF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: F6WJ76.pir
Inward Open:
Template: 5CTG.pdb
Model structure: F6WJ76_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.5% favored 9.4% allowed 1.0% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: F6WJ76_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 6.8% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: F6WJ76_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.8% allowed 1.0% week .0% disallowed
Gene Informationback to top
Gene ID: 101243376 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA