Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F6WJ76

dbSWEET id: dbswt_1171

Accession:   F6WJ76

Uniprot status:   Unreviewed

Organism:   Ciona intestinalis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Tunicata ⇒ Ascidiacea ⇒ Enterogona ⇒ Phlebobranchia ⇒ Cionidae ⇒ Ciona.

Sequence Information back to top


Sequence length:   222

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   LSNV           CVV:   398       CHI:   3.7

Fasta sequence:

>tr|F6WJ76|F6WJ76_CIOIN|Unreviewed|Ciona_intestinalis|222
MDWGVVEIVSFVATVTNVLLFLSGIQIISKIYTRGSSQGFSVLPFIVCFVSSTLWTKYGL
LSEDSIMILVNFIGVVIEGFYTAVFYLNTKQKQKKLQMTIFSLLAFMFAVLIYTKYFVNQ
DLALKHHGFICAAFNIINYAAPLSSAAVVIRKKSTENLSLLLSVVYFLVSVEWFFYGYLH
QDNFIMIPNTLGILFCSFQLSLFVFYPSKRTISDHKPDIVTF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: F6WJ76.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  F6WJ76_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.5% favored    9.4% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  F6WJ76_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    6.8% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  F6WJ76_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.8% allowed    1.0% week    .0% disallowed

Gene Informationback to top


Gene ID:   101243376     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur