| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F6U696
dbSWEET id: dbswt_1170
Accession: F6U696
Uniprot status: Unreviewed
Organism: Ciona intestinalis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Tunicata ⇒ Ascidiacea ⇒ Enterogona ⇒ Phlebobranchia ⇒ Cionidae ⇒ Ciona.
Sequence Information back to top
Sequence length: 215
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: MNMC CVV: 430 CHI: 2.8
Fasta sequence:
>tr|F6U696|F6U696_CIOIN|Unreviewed|Ciona_intestinalis|215
MAEFWISFFSNGCIAVTIIMFATGIPQCMEMMKKKTTKNIPFLPYLITNVNAIGWIIYGK
MTVNFTVVFVNTIGAGLQTLYMAVYIFFAADKSKPLVQSSVCGGAAAITWYIITQFANVI
DAINVTGIICCTVTIFMFASPLAEINTVIANKSTATISLPLTVTASLCSAMWTMFGLVLH
DNFIIIPNVLGFFAAFSRFYLFYKYPSSPGLPHSV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 207
Alignment file: F6U696.pir
Inward Open:
Template: 5CTG.pdb
Model structure: F6U696_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 7.0% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: F6U696_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: F6U696_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 4.3% allowed 2.2% week .5% disallowed
Gene Informationback to top
Gene ID: 100185787 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA