Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F6U696

dbSWEET id: dbswt_1170

Accession:   F6U696

Uniprot status:   Unreviewed

Organism:   Ciona intestinalis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Tunicata ⇒ Ascidiacea ⇒ Enterogona ⇒ Phlebobranchia ⇒ Cionidae ⇒ Ciona.

Sequence Information back to top


Sequence length:   215

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   MNMC           CVV:   430       CHI:   2.8

Fasta sequence:

>tr|F6U696|F6U696_CIOIN|Unreviewed|Ciona_intestinalis|215
MAEFWISFFSNGCIAVTIIMFATGIPQCMEMMKKKTTKNIPFLPYLITNVNAIGWIIYGK
MTVNFTVVFVNTIGAGLQTLYMAVYIFFAADKSKPLVQSSVCGGAAAITWYIITQFANVI
DAINVTGIICCTVTIFMFASPLAEINTVIANKSTATISLPLTVTASLCSAMWTMFGLVLH
DNFIIIPNVLGFFAAFSRFYLFYKYPSSPGLPHSV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: F6U696.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  F6U696_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    7.0% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  F6U696_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.9% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  F6U696_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.3% allowed    2.2% week    .5% disallowed

Gene Informationback to top


Gene ID:   100185787     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur