| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F5W0L8
dbSWEET id: dbswt_1776
Accession: F5W0L8
Uniprot status: Unreviewed
Organism: Streptococcus infantis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|F5W0L8|F5W0L8_9STRE|Unreviewed|Streptococcus infantis|86
MTEKQMKTLGWIATFMSVMMYISYIPQIMNNLAGQKGNFIQPAVAAINCSLWVYYGLFKK
ERDIPLAAANAPGIVFGIITALTALF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: F5W0L8_inward.pdb Alignment file: F5W0L8_inw.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 7.7% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: F5W0L8_outward.pdb Alignment file: F5W0L8_out.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 6.2% allowed 1.5% week 2.3% disallowed Occluded: Model structure: F5W0L8_occluded.pdb Alignment file: F5W0L8_occ.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 6.9% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA