Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F5RNF1

dbSWEET id: dbswt_1773

Accession:   F5RNF1

Uniprot status:   Unreviewed

Organism:   Centipeda periodontii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Centipeda.

Sequence Information back to top


Sequence length:   81

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|F5RNF1|F5RNF1_9FIRM|Unreviewed|Centipeda periodontii|81
MKIVGVIASGLSICMYVSYIPQNLGNLSGHQGDWIQPFVAFINCTMWVGYGFFKEHRDWP
LVIANSPGIIFGLTAAITARL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  F5RNF1_inward.pdb    Alignment file: F5RNF1_inw.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.9% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F5RNF1_outward.pdb    Alignment file: F5RNF1_out.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.9% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F5RNF1_occluded.pdb    Alignment file: F5RNF1_occ.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    7.3% allowed    3.2% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur