| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : F3A7W3
dbSWEET id: dbswt_1770
Accession: F3A7W3
Uniprot status: Unreviewed
Organism: Gemella sanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Bacillales ⇒ Bacillales Family XI. Incertae Sedis ⇒ Gemella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|F3A7W3|F3A7W3_9BACL|Unreviewed|Gemella sanguinis|87
MTKQKINRIVGSIGAFIGIFVFIAYIPQIISNLHGVKAQPFQPLFAAVSCLIWVIYGWTK
EPKKDWILIIPNAAGVVLGGLTFLTSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: F3A7W3_inward.pdb Alignment file: F3A7W3_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 6.3% allowed 2.4% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: F3A7W3_outward.pdb Alignment file: F3A7W3_out.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed .8% week .8% disallowed Occluded: Model structure: F3A7W3_occluded.pdb Alignment file: F3A7W3_occ.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 5.6% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA