Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F3A7W3

dbSWEET id: dbswt_1770

Accession:   F3A7W3

Uniprot status:   Unreviewed

Organism:   Gemella sanguinis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Bacillales ⇒ Bacillales Family XI. Incertae Sedis ⇒ Gemella.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|F3A7W3|F3A7W3_9BACL|Unreviewed|Gemella sanguinis|87
MTKQKINRIVGSIGAFIGIFVFIAYIPQIISNLHGVKAQPFQPLFAAVSCLIWVIYGWTK
EPKKDWILIIPNAAGVVLGGLTFLTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  F3A7W3_inward.pdb    Alignment file: F3A7W3_inw.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    6.3% allowed    2.4% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  F3A7W3_outward.pdb    Alignment file: F3A7W3_out.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  F3A7W3_occluded.pdb    Alignment file: F3A7W3_occ.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.6% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur