Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : F3A7T6
dbSWEET id: dbswt_1769
Accession: F3A7T6
Uniprot status: Unreviewed
Organism: Gemella sanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Bacillales ⇒ Bacillales Family XI. Incertae Sedis ⇒ Gemella.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|F3A7T6|F3A7T6_9BACL|Unreviewed|Gemella sanguinis|85
MNNKFFKILSWVATFTAMLMYISYIPQISGNINGHKGDFLQPFVAGINCTLWVLYGFLGE
KRDWPIIIANSPGIIFGFTAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: F3A7T6_inward.pdb Alignment file: F3A7T6_inw.pir Procheck score ⇒ Ramachandran plot: 91.1% favored 8.9% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: F3A7T6_outward.pdb Alignment file: F3A7T6_out.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 5.6% allowed .0% week .0% disallowed Occluded: Model structure: F3A7T6_occluded.pdb Alignment file: F3A7T6_occ.pir Procheck score ⇒ Ramachandran plot: 92.7% favored 5.6% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA