Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : F2CRA4

dbSWEET id: dbswt_479

Accession:   F2CRA4

Uniprot status:   Unreviewed

Organism:   Hordeum vulgare

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Hordeinae ⇒ Hordeum.

Sequence Information back to top


Sequence length:   269

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VNMN           CVV:   421       CHI:   -0.9

Fasta sequence:

>tr|F2CRA4|F2CRA4_HORVD|Unreviewed|Hordeum_vulgare|269
MHLFFLLPSTGFLGWQLRAMNSTLFIIGVIGNIISVLVFVSPIPTFWRLVRNRSTEDFEA
APYVLTLLNTLLWLYYGLTKPDGLLIATVNGFGAVMETIYVVLFLVYAADNVKRVKTAKL
VAALDIGFFGIVFVATTFAIGGLDMKIIVIGLICACLSVFMYGSPLAAVRTVIASRSVEY
MPFFLSFFLFLNGGVWAMYAILDRDVFLGVPNGIGCFLGGIQLVIYAAYKNSKVGCQSPN
NDEVAYDASTSLLSSDDRRYGQNDVSIRV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   17     Model end:   231

Alignment file: F2CRA4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  F2CRA4_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.3% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  F2CRA4_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.8% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  F2CRA4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    4.8% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur